PDB entry 1i16

View 1i16 on RCSB PDB site
Description:
Deposited on 1998-05-20, released 1999-05-25
The last revision prior to the SCOP 1.61 freeze date was dated 1999-05-25, with a file datestamp of 1999-05-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i16__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i16_ (-)
    mpdlnsstdsaasasaasdvsvestaeatvctvtlekmsaglgfsleggkgslhgdkplt
    inrifkgaaseqsetvqpgdeilqlggtamqgltrfeawniikalpdgpvtivirrkslq
    skettaagds