PDB entry 1i12

View 1i12 on RCSB PDB site
Description: crystal structure of saccharomyces cerevisiae gna1 complexed with accoa
Class: transferase
Keywords: gnat, alpha/beta, transferase
Deposited on 2001-01-30, released 2001-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.21
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine-phosphate n-acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFL017C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43577 (Start-159)
      • engineered (39)
    Domains in SCOPe 2.06: d1i12a_
  • Chain 'B':
    Compound: glucosamine-phosphate n-acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFL017C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43577 (Start-159)
      • engineered (39)
    Domains in SCOPe 2.06: d1i12b_
  • Chain 'C':
    Compound: glucosamine-phosphate n-acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFL017C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43577 (1-End)
      • cloning artifact (0)
      • engineered (39)
    Domains in SCOPe 2.06: d1i12c1, d1i12c2
  • Chain 'D':
    Compound: glucosamine-phosphate n-acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFL017C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43577 (1-159)
      • cloning artifact (0)
      • engineered (39)
    Domains in SCOPe 2.06: d1i12d1, d1i12d2
  • Heterogens: ACO, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i12A (A:)
    smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkki
    mqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidql
    vtigfdygcykiildcdeknvkfyekcgfsnagvemqirk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i12A (A:)
    lpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndkkimqynpm
    vivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigfd
    ygcykiildcdeknvkfyekcgfsnagvemqirk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i12B (B:)
    smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkki
    mqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidql
    vtigfdygcykiildcdeknvkfyekcgfsnagvemqirk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i12B (B:)
    slpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwnkkimqynpm
    vivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigfd
    ygcykiildcdeknvkfyekcgfsnagvemqirk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i12C (C:)
    smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkki
    mqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidql
    vtigfdygcykiildcdeknvkfyekcgfsnagvemqirk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i12C (C:)
    smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwnkimqynp
    mvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigf
    dygcykiildcdeknvkfyekcgfsnagvemqir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i12D (D:)
    smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkki
    mqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidql
    vtigfdygcykiildcdeknvkfyekcgfsnagvemqirk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i12D (D:)
    smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnkimqy
    npmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvti
    gfdygcykiildcdeknvkfyekcgfsnagvemqirk