PDB entry 1i11

View 1i11 on RCSB PDB site
Description: solution structure of the dna binding domain, sox-5 hmg box from mouse
Deposited on 2001-01-30, released 2001-02-14
The last revision prior to the SCOP 1.69 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1i11a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1i11A (A:)
gsphikrpmnafmvwakderrkilqafpdmhnsniskilgsrwkamtnlekqpyyeeqar
lskqhlekypdykykprpkrt

    Sequence, based on observed residues (ATOM records): (download) 
    >1i11A (A:)
phikrpmnafmvwakderrkilqafpdmhnsniskilgsrwkamtnlekqpyyeeqarls
kqhlekypdy