PDB entry 1i11

View 1i11 on RCSB PDB site
Description: solution structure of the dna binding domain, sox-5 hmg box from mouse
Deposited on 2001-01-30, released 2001-02-14
The last revision prior to the SCOP 1.57 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1i11a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i11A (A:)
    phikrpmnafmvwakderrkilqafpdmhnsniskilgsrwkamtnlekqpyyeeqarls
    kqhlekypdy