PDB entry 1i11

View 1i11 on RCSB PDB site
Description: solution structure of the DNA binding domain, sox-5 hmg box from mouse
Class: DNA binding protein
Keywords: hmg box, DNA bending, DNA recognition, chromatin, nmr, DNA binding protein, DNA sequence specific, testis determining.
Deposited on 2001-01-30, released 2001-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor sox-5
    Species: Mus musculus [TaxId:10090]
    Gene: SOX-5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i11a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i11A (A:)
    gsphikrpmnafmvwakderrkilqafpdmhnsniskilgsrwkamtnlekqpyyeeqar
    lskqhlekypdykykprpkrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i11A (A:)
    phikrpmnafmvwakderrkilqafpdmhnsniskilgsrwkamtnlekqpyyeeqarls
    kqhlekypdy