PDB entry 1i10

View 1i10 on RCSB PDB site
Description: human muscle l-lactate dehydrogenase m chain, ternary complex with nadh and oxamate
Class: oxidoreductase
Keywords: dehydrogenase, rossmann fold, oxidoreductase
Deposited on 2001-01-30, released 2001-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase m chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i10a1, d1i10a2
  • Chain 'B':
    Compound: l-lactate dehydrogenase m chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i10b1, d1i10b2
  • Chain 'C':
    Compound: l-lactate dehydrogenase m chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i10c1, d1i10c2
  • Chain 'D':
    Compound: l-lactate dehydrogenase m chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i10d1, d1i10d2
  • Chain 'E':
    Compound: l-lactate dehydrogenase m chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i10e1, d1i10e2
  • Chain 'F':
    Compound: l-lactate dehydrogenase m chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i10f1, d1i10f2
  • Chain 'G':
    Compound: l-lactate dehydrogenase m chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i10g1, d1i10g2
  • Chain 'H':
    Compound: l-lactate dehydrogenase m chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i10h1, d1i10h2
  • Heterogens: ACT, NAI, OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i10A (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i10B (B:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i10C (C:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i10D (D:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i10E (E:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i10F (F:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1i10G (G:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i10G (G:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqnlvqrnvnifkfiipnvvky
    spnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhplschg
    wvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayeviklkgy
    tswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngisdlvkvt
    ltseeearlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i10H (H:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf