PDB entry 1i0y

View 1i0y on RCSB PDB site
Description: solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
Deposited on 2001-01-30, released 2001-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1i0ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i0yA (A:)
  anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfaadgvdadtaaklshkg
  lafaagesftstftepgtytyycephrgagmvgkvvvd