PDB entry 1i0s

View 1i0s on RCSB PDB site
Description: archaeoglobus fulgidus ferric reductase complex with nadp+
Deposited on 2001-01-29, released 2001-05-02
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.191
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i0sa_
  • Chain 'B':
    Domains in SCOP 1.59: d1i0sb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i0sA (A:)
    mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
    afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
    cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i0sB (B:)
    mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
    afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
    cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprtatvyfes