PDB entry 1i0r

View 1i0r on RCSB PDB site
Description: crystal structure of ferric reductase from archaeoglobus fulgidus
Deposited on 2001-01-29, released 2001-05-02
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1i0ra_
  • Chain 'B':
    Domains in SCOP 1.63: d1i0rb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i0rA (A:)
    mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
    afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
    cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i0rB (B:)
    mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
    afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
    cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprtatvyfes