PDB entry 1i0h

View 1i0h on RCSB PDB site
Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
Class: oxidoreductase
Keywords: manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, OXIDOREDUCTASE
Deposited on 2001-01-29, released 2001-02-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.17
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase y174f mutant
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (173)
    Domains in SCOPe 2.05: d1i0ha1, d1i0ha2
  • Chain 'B':
    Compound: manganese superoxide dismutase y174f mutant
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (173)
    Domains in SCOPe 2.05: d1i0hb1, d1i0hb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i0hA (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayflkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i0hB (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayflkfqnr
    rpdyikefwnvvnwdeaaarfaakk