PDB entry 1hzv

View 1hzv on RCSB PDB site
Description: domain swing upon his to ala mutation in nitrite reductase of pseudomonas aeruginosa
Class: oxidoreductase
Keywords: 8-bladed beta propeller, OXIDOREDUCTASE
Deposited on 2001-01-26, released 2001-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.282
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: NIRS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24474 (Start-542)
      • engineered (368)
    Domains in SCOPe 2.07: d1hzva1, d1hzva2
  • Heterogens: HEC, DHE, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hzvA (A:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktpapgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzvA (A:)
    vrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpditqqrgqqyleality
    gtplgmelskeqitlmakyiqhtppqppewgmpemreswkvlvkpedrpkkqlndldlpn
    lfsvtlrdagqialvdgdskkivkvidtgyavhisrmsasgryllvigrdaridmidlwa
    keptkvaeikigiearsvesskfkgyedrytiagaywppqfaimdgetlepkqivstrgm
    tvdtqtyhpeprvaaiiashehpefivnvketgkvllvnykdidnltvtsigaapflhdg
    gwdsshryfmtaannsnkvavidskdrrlsalvdvgktpapgrganfvhpkygpvwstsh
    lgdgsisligtdpknhpqyawkkvaelqgqgggslfikthpksshlyvdttfnpdarisq
    svavfdlknldakyqvlpiaewadlgegakrvvqpeynkrgdevwfsvwngkndssalvv
    vddktlklkavvkdprlitptgkfnvyntqhdvy