PDB entry 1hzt

View 1hzt on RCSB PDB site
Description: crystal structure of metal-free isopentenyl diphosphate:dimethylallyl diphosphate isomerase
Deposited on 2001-01-26, released 2001-07-26
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-26, with a file datestamp of 2001-07-26.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.192
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1hzta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hztA (A:)
lhlafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgv
eitppesiypdfryratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhg
idatpwafspwmvmqatnrearkrlsaftqlkl