PDB entry 1hzt

View 1hzt on RCSB PDB site
Description: crystal structure of metal-free isopentenyl diphosphate:dimethylallyl diphosphate isomerase
Class: isomerase
Keywords: isopentenyl, dimethylallyl, isoprenoids, isomerase
Deposited on 2001-01-26, released 2001-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.192
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isopentenyl diphosphate delta-isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: IDI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822 (Start-181)
      • cloning artifact (182)
    Domains in SCOPe 2.07: d1hzta1, d1hzta2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hztA (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hztA (A:)
    lhlafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgv
    eitppesiypdfryratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhg
    idatpwafspwmvmqatnrearkrlsaftqlkl