PDB entry 1hzp

View 1hzp on RCSB PDB site
Description: Crystal Structure of the Myobacterium Tuberculosis Beta-Ketoacyl-Acyl Carrier Protein Synthase III
Class: transferase
Keywords: fatty acid biosynthesis, myobacterium tuberculosis, structural basis for substrate specificity, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2001-01-25, released 2001-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase III
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hzpa1, d1hzpa2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase III
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hzpb1, d1hzpb2
  • Heterogens: DAO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hzpA (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzpA (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hzpB (B:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzpB (B:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpk