PDB entry 1hzi

View 1hzi on RCSB PDB site
Description: interleukin-4 mutant e9a
Class: cytokine
Keywords: il-4, 4-helix-bundle, cytokine
Deposited on 2001-01-25, released 2001-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05112 (0-128)
      • engineered (8)
    Domains in SCOPe 2.07: d1hzia_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hziA (A:)
hkcditlqaiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim
rekyskcss