PDB entry 1hzh

View 1hzh on RCSB PDB site
Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
Deposited on 2001-01-24, released 2001-08-15
The last revision prior to the SCOP 1.69 freeze date was dated 2002-06-12, with a file datestamp of 2002-06-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhH (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkthtcppcp
    apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktk
    preeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyt
    lppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskl
    tvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1hzhK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkthtcppcp
    apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktk
    preeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyt
    lppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskl
    tvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzhK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkcppcpapellggpsv
    flfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynsty
    rvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltk
    nqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqg
    nvfscsvmhealhnhytqkslsls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhL (L:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhM (M:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec