PDB entry 1hzg

View 1hzg on RCSB PDB site
Description: crystal structure of the inactive c866s mutant of the catalytic domain of e. coli cytotoxic necrotizing factor 1
Class: toxin
Keywords: Beta Sandwich, Rho Deamidase, Rho Transglutaminase, TOXIN
Deposited on 2001-01-24, released 2001-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytotoxic necrotizing factor 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47106 (0-294)
      • see remark 999 (74)
      • engineered (146)
    Domains in SCOPe 2.08: d1hzga_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzgA (A:)
    siestsksnfqklsrgnidvlkgrgsisstrqraiypyfeaanadeqqplffyikkdrfd
    nhgydqyfydntvgpngiptlntytgeipsdssslgstywkkynltnetsiirvsnsarg
    angikialeevqegkpviitsgnlsgsttivarkegyiykvhtgttkslagftsttgvkk
    avevlelltkepiprvegimsndflvdylsenfedslitysssekkpdsqitiirdnvsv
    fpyfldnipehgfgtsatvlvrvdgnvvvrslsesyslnadaseisvlkvfskkf