PDB entry 1hze
View 1hze on RCSB PDB site
Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli
Class: transferase
Keywords: greek-key-barrel, TRANSFERASE
Deposited on
2001-01-24, released
2001-09-05
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: riboflavin synthase alpha chain
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1hzea_ - Chain 'B':
Compound: riboflavin synthase alpha chain
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1hzeb_ - Heterogens: RBF
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1hzeA (A:)
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1hzeB (B:)
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh