PDB entry 1hze

View 1hze on RCSB PDB site
Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli
Class: transferase
Keywords: greek-key-barrel, TRANSFERASE
Deposited on 2001-01-24, released 2001-09-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: riboflavin synthase alpha chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hzea_
  • Chain 'B':
    Compound: riboflavin synthase alpha chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hzeb_
  • Heterogens: RBF

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzeA (A:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeiggh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzeB (B:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeiggh