PDB entry 1hze

View 1hze on RCSB PDB site
Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli
Class: transferase
Keywords: greek-key-barrel
Deposited on 2001-01-24, released 2001-09-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: riboflavin synthase alpha chain
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29015 (0-96)
  Domains in SCOP 1.73: d1hzea_
• Chain 'B':
  Compound: riboflavin synthase alpha chain
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29015 (0-96)
  Domains in SCOP 1.73: d1hzeb_
• Heterogens: RBF

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hzeA (A:)
  mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
  fdlmketlritnlgdlkvgdwvnveraakfsdeiggh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hzeB (B:)
  mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
  fdlmketlritnlgdlkvgdwvnveraakfsdeiggh