PDB entry 1hze

View 1hze on RCSB PDB site
Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli
Deposited on 2001-01-24, released 2001-09-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-09-05, with a file datestamp of 2001-09-05.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hzea_
  • Chain 'B':
    Domains in SCOP 1.59: d1hzeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzeA (A:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeiggh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzeB (B:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeiggh