PDB entry 1hzd

View 1hzd on RCSB PDB site
Description: crystal structure of human auh protein, an rna-binding homologue of enoyl-coa hydratase
Deposited on 2001-01-24, released 2001-12-12
The last revision prior to the SCOP 1.63 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1hzda_
  • Chain 'B':
    Domains in SCOP 1.63: d1hzdb_
  • Chain 'C':
    Domains in SCOP 1.63: d1hzdc_
  • Chain 'D':
    Domains in SCOP 1.63: d1hzdd_
  • Chain 'E':
    Domains in SCOP 1.63: d1hzde_
  • Chain 'F':
    Domains in SCOP 1.63: d1hzdf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzdA (A:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzdB (B:)
    delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
    gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
    dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
    shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
    tiptkdrlegllafkekrpprykge
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzdC (C:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzdD (D:)
    delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
    gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
    dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
    shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
    tiptkdrlegllafkekrpprykge
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzdE (E:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzdF (F:)
    delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
    gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
    dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
    shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
    tiptkdrlegllafkekrpprykge