PDB entry 1hzd

View 1hzd on RCSB PDB site
Description: crystal structure of human auh protein, an RNA-binding homologue of enoyl-coa hydratase
Class: lyase
Keywords: RNA-binding protein,enoyl-CoA hydratase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2001-01-24, released 2001-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: au-binding protein/enoyl-coa hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hzda_
  • Chain 'B':
    Compound: au-binding protein/enoyl-coa hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hzdb_
  • Chain 'C':
    Compound: au-binding protein/enoyl-coa hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hzdc_
  • Chain 'D':
    Compound: au-binding protein/enoyl-coa hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hzdd_
  • Chain 'E':
    Compound: au-binding protein/enoyl-coa hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hzde_
  • Chain 'F':
    Compound: au-binding protein/enoyl-coa hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hzdf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hzdA (A:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzdA (A:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hzdB (B:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzdB (B:)
    delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
    gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
    dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
    shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
    tiptkdrlegllafkekrpprykge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hzdC (C:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzdC (C:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hzdD (D:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzdD (D:)
    delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
    gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
    dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
    shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
    tiptkdrlegllafkekrpprykge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hzdE (E:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzdE (E:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hzdF (F:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzdF (F:)
    delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
    gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
    dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
    shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
    tiptkdrlegllafkekrpprykge