PDB entry 1hzc

View 1hzc on RCSB PDB site
Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Class: transcription
Keywords: beta barrel, homodimer
Deposited on 2001-01-24, released 2001-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.144
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock protein cspB
    Species: Bacillus caldolyticus
    Gene: cspB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41016 (0-65)
      • engineered (2)
      • engineered (45)
      • engineered (65)
    Domains in SCOP 1.73: d1hzca_
  • Chain 'B':
    Compound: Cold shock protein cspB
    Species: Bacillus caldolyticus
    Gene: cspB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41016 (0-65)
      • engineered (2)
      • engineered (45)
      • engineered (65)
    Domains in SCOP 1.73: d1hzcb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzcA (A:)
    mqegkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqavsfeivqgnrgpqa
    anvvke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzcB (B:)
    mqegkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqavsfeivqgnrgpqa
    anvvke