PDB entry 1hz6

View 1hz6 on RCSB PDB site
Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus with a tyrosine to tryptophan substitution
Class: protein binding
Keywords: Four stranded beta-sheet with central alpha helix, binds kappa light chain of immunoglobulins, PROTEIN BINDING
Deposited on 2001-01-23, released 2001-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • expression tag (5-7)
      • cloning artifact (8)
      • engineered (54)
    Domains in SCOPe 2.06: d1hz6a1, d1hz6a2
  • Chain 'B':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • engineered (54)
    Domains in SCOPe 2.06: d1hz6b_
  • Chain 'C':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • engineered (54)
    Domains in SCOPe 2.06: d1hz6c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hz6A (A:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hz6A (A:)
    hhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgyt
    lnikfag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hz6B (B:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hz6B (B:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
    fag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hz6C (C:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hz6C (C:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
    fag