PDB entry 1hz6

View 1hz6 on RCSB PDB site
Description:
Deposited on 2001-01-23, released 2001-04-04
The last revision prior to the SCOP 1.65 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1hz6a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1hz6b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1hz6c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hz6A (A:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hz6A (A:)
    hhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgyt
    lnikfag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hz6B (B:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hz6B (B:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
    fag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hz6C (C:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hz6C (C:)
    eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
    fag