PDB entry 1hz6

View 1hz6 on RCSB PDB site
Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus with a tyrosine to tryptophan substitution
Deposited on 2001-01-23, released 2001-04-04
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1hz6a_
  • Chain 'B':
    Domains in SCOP 1.57: d1hz6b_
  • Chain 'C':
    Domains in SCOP 1.57: d1hz6c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hz6A (A:)
hhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgyt
lnikfag

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hz6B (B:)
eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
fag

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hz6C (C:)
eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
fag