PDB entry 1hz5

View 1hz5 on RCSB PDB site
Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus, with a tyrosine to tryptophan substitution
Deposited on 2001-01-23, released 2001-04-04
The last revision prior to the SCOP 1.67 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1hz5a_
  • Chain 'B':
    Domains in SCOP 1.67: d1hz5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hz5A (A:)
mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
dkgytlnikfag

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hz5B (B:)
mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
dkgytlnikfag