PDB entry 1hz4

View 1hz4 on RCSB PDB site
Description: crystal structure of transcription factor malt domain III
Class: transcription activator
Keywords: two-helix bundles, helix repeats, protein superhelix, TRANSCRIPTION ACTIVATOR
Deposited on 2001-01-23, released 2001-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.189
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malt regulatory protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hz4a_
  • Heterogens: SO4, BEZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hz4A (A:)
    gheikdiredtmhaefnalraqvaindgnpdeaerlaklaleelppgwfysrivatsvlg
    evlhckgeltrslalmqqteqmarqhdvwhyalwsliqqseilfaqgflqtawetqekaf
    qlineqhleqlpmheflvriraqllwawarldeaeasarsgievlssyqpqqqlqclaml
    iqcslargdldnarsqlnrlenllgngkyhsdwisnankvrviywqmtgdkaaaanwlrh
    takpefannhflqgqwrniaraqillgefepaeivleelnenarslrlmsdlnrnlllln
    qlywqagrksdaqrvlldalklanrtgfishfviegeamaqqlrqliqlntlpeleqhra
    qrilreinqhhga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hz4A (A:)
    eikdiredtmhaefnalraqvaindgnpdeaerlaklaleelppgwfysrivatsvlgev
    lhckgeltrslalmqqteqmarqhdvwhyalwsliqqseilfaqgflqtawetqekafql
    ineqhleqlpmheflvriraqllwawarldeaeasarsgievlssyqpqqqlqclamliq
    cslargdldnarsqlnrlenllgngkyhsdwisnankvrviywqmtgdkaaaanwlrhta
    kpefannhflqgqwrniaraqillgefepaeivleelnenarslrlmsdlnrnllllnql
    ywqagrksdaqrvlldalklanrtgfishfviegeamaqqlrqliqlntlpeleqhraqr
    ilrein