PDB entry 1hyu

View 1hyu on RCSB PDB site
Description: crystal structure of intact ahpf
Deposited on 2001-01-22, released 2001-02-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-25, with a file datestamp of 2001-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hyuA (A:)
    mldtnmktqlraylekltkpveliatlddsaksaeikellaeiaelsdkvtfkedntlpv
    rkpsflitnpgsqqgprfagsplgheftslvlallwtgghpskeaqslleqirdidgdfe
    fetyyslschncpdvvqalnlmavlnprikhtaidggtfqneiternvmgvpavfvngke
    fgqgrmtlteivakvdtgaekraaealnkrdaydvlivgsgpagaaaavysarkgirtgl
    mgerfggqvldtvdienyisvpktegqklagalkahvsdydvdvidsqsasklvpaateg
    glhqietasgavlkarsiiiatgakwrnmnvpgedqyrtkgvtycphcdgplfkgkrvav
    igggnsgveaaidlagivehvtllefapemkadqvlqdkvrslknvdiilnaqttevkgd
    gskvvgleyrdrvsgdihsvalagifvqigllpnthwlegalernrmgeiiidakcetsv
    kgvfaagdcttvpykqiiiatgegakaslsafdylirtkia