PDB entry 1hym

View 1hym on RCSB PDB site
Description: hydrolyzed trypsin inhibitor (cmti-v, minimized average nmr structure)
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1995-06-12, released 1995-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hydrolyzed cucurbita maxima trypsin inhibitor v
  Species: Cucurbita maxima [TaxId:3661]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19873 (0-43)
  Domains in SCOPe 2.04: d1hym.1
• Chain 'B':
  Compound: hydrolyzed cucurbita maxima trypsin inhibitor v
  Species: Cucurbita maxima [TaxId:3661]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19873 (0-23)
  Domains in SCOPe 2.04: d1hym.1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hymA (A:)
  sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hymB (B:)
  dfrcnrvriwvnkrglvvspprig