PDB entry 1hym

View 1hym on RCSB PDB site
Description: hydrolyzed trypsin inhibitor (cmti-v, minimized average nmr structure)
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1995-06-12, released 1995-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrolyzed cucurbita maxima trypsin inhibitor v
    Species: Cucurbita maxima [TaxId:3661]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hym.1
  • Chain 'B':
    Compound: hydrolyzed cucurbita maxima trypsin inhibitor v
    Species: Cucurbita maxima [TaxId:3661]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hym.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hymA (A:)
    sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hymB (B:)
    dfrcnrvriwvnkrglvvspprig