PDB entry 1hym

View 1hym on RCSB PDB site
Description: hydrolyzed trypsin inhibitor (cmti-v, minimized average nmr structure)
Deposited on 1995-06-12, released 1995-09-15
The last revision prior to the SCOP 1.65 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1hym.1
  • Chain 'B':
    Domains in SCOP 1.65: d1hym.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hymA (A:)
sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hymB (B:)
dfrcnrvriwvnkrglvvspprig