PDB entry 1hyh

View 1hyh on RCSB PDB site
Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits
Class: oxidoreductase (choh(d)-nad+(a))
Keywords: l-2-hydroxycarboxylate dehydrogenase, l-lactate dehydrogenase, oxidoreductase (choh(d)-nad+(a))
Deposited on 1995-06-05, released 1995-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-2-hydroxyisocaproate dehydrogenase
    Species: Weissella confusa [TaxId:1583]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hyha1, d1hyha2
  • Chain 'B':
    Compound: l-2-hydroxyisocaproate dehydrogenase
    Species: Weissella confusa [TaxId:1583]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hyhb1, d1hyhb2
  • Chain 'C':
    Compound: l-2-hydroxyisocaproate dehydrogenase
    Species: Weissella confusa [TaxId:1583]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hyhc1, d1hyhc2
  • Chain 'D':
    Compound: l-2-hydroxyisocaproate dehydrogenase
    Species: Weissella confusa [TaxId:1583]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hyhd1, d1hyhd2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hyhA (A:)
    arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
    indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
    isnpvdvitalfqhvtgfpahkvigtgtlldtarmqravgeafdldprsvsgynlgehgn
    sqfvawstvrvmgqpivtladagdidlaaieeearkggftvlngkgytsygvatsairia
    kavmadahaelvvsnrrddmgmylsypaiigrdgvlaettldlttdeqekllqsrdyiqq
    rfdeivdtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyhA (A:)
    arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
    indwaaladadvvistlgniklqqfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdv
    italfqhvtgfpahkvigtgtlldtarmqravgeafdldprsvsgynlgehgnsqfvaws
    tvrvmgqpivtlidlaaieeearkggftvlngkgytsygvatsairiakavmadahaelv
    vsnrrddmgmylsypaiigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hyhB (B:)
    arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
    indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
    isnpvdvitalfqhvtgfpahkvigtgtlldtarmqravgeafdldprsvsgynlgehgn
    sqfvawstvrvmgqpivtladagdidlaaieeearkggftvlngkgytsygvatsairia
    kavmadahaelvvsnrrddmgmylsypaiigrdgvlaettldlttdeqekllqsrdyiqq
    rfdeivdtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyhB (B:)
    arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
    indwaaladadvvistlgniklqqfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdv
    italfqhvtgfpahkvigtgtlldtarmqravgeafdldprsvsgynlgehgnsqfvaws
    tvrvmgqpivtlidlaaieeearkggftvlngkgytsygvatsairiakavmadahaelv
    vsnrrddmgmylsypaiigrdgvlaettldlttdeqekllqsrdyiqqrfdeiv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hyhC (C:)
    arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
    indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
    isnpvdvitalfqhvtgfpahkvigtgtlldtarmqravgeafdldprsvsgynlgehgn
    sqfvawstvrvmgqpivtladagdidlaaieeearkggftvlngkgytsygvatsairia
    kavmadahaelvvsnrrddmgmylsypaiigrdgvlaettldlttdeqekllqsrdyiqq
    rfdeivdtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyhC (C:)
    arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
    indwaaladadvvistlggdrfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdvita
    lfqhvtgfpahkvigtgtlldtarmqravgeafdldprsvsgynlgehgnsqfvawstvr
    vmgqpivtladaidlaaieeearkggftvlngkgytsygvatsairiakavmadahaelv
    vsnrrddmgmylsypaiigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hyhD (D:)
    arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
    indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
    isnpvdvitalfqhvtgfpahkvigtgtlldtarmqravgeafdldprsvsgynlgehgn
    sqfvawstvrvmgqpivtladagdidlaaieeearkggftvlngkgytsygvatsairia
    kavmadahaelvvsnrrddmgmylsypaiigrdgvlaettldlttdeqekllqsrdyiqq
    rfdeivdtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyhD (D:)
    arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
    indwaaladadvvistlggdrfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdvita
    lfqhvtgfpahkvigtgtlldtarmqravgeafdldprsvsgynlgehgnsqfvawstvr
    vmgqpivtladaidlaaieeearkggftvlngkgytsygvatsairiakavmadahaelv
    vsnrrddmgmylsypaiigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl