PDB entry 1hyf

View 1hyf on RCSB PDB site
Description: ribonuclease t1 v16a mutant in complex with sr2+
Class: hydrolase
Keywords: Ribonuclease, stability, metal binding, HYDROLASE
Deposited on 2001-01-19, released 2001-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: guanyl-specific ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • engineered (15)
    • see remark 999 (24)
  Domains in SCOPe 2.06: d1hyfa_
• Heterogens: SR, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hyfA (A:)
  acdytcgsncysssdastaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect