PDB entry 1hyf

View 1hyf on RCSB PDB site
Description: ribonuclease t1 v16a mutant in complex with sr2+
Deposited on 2001-01-19, released 2001-02-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hyfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hyfA (A:)
acdytcgsncysssdastaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect