PDB entry 1hy9

View 1hy9 on RCSB PDB site
Description: cocaine and amphetamine regulated transcript
Deposited on 2001-01-18, released 2001-08-29
The last revision prior to the SCOP 1.59 freeze date was dated 2001-09-05, with a file datestamp of 2001-09-05.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hy9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hy9A (A:)
    ygqvpmcdageqcavrkgarigklcdcprgtscnsfllkcl