PDB entry 1hy5

View 1hy5 on RCSB PDB site
Description: crystal structure of the catalytic domain of yope-yersinia pestis gap effector protein.
Class: toxin
Keywords: four helix up-down-up-down antiparallel bundle, beta hairpin, arginine finger, toxin
Deposited on 2001-01-18, released 2002-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yersinia pestis virulence protein yope
    Species: Yersinia pestis [TaxId:632]
    Gene: YOPE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31493
      • modified residue (28)
      • modified residue (38)
      • modified residue (64)
      • modified residue (122)
      • modified residue (129)
    Domains in SCOPe 2.07: d1hy5a_
  • Chain 'B':
    Compound: yersinia pestis virulence protein yope
    Species: Yersinia pestis [TaxId:632]
    Gene: YOPE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31493 (Start-129)
      • modified residue (28)
      • modified residue (38)
      • modified residue (64)
      • modified residue (122)
      • modified residue (129)
      • expression tag (130)
    Domains in SCOPe 2.07: d1hy5b1, d1hy5b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hy5A (A:)
    aptpaqmpsptsfsdsikqlaaetlpkymqqlnsldaemlqknhdqfatgsgplrgsitq
    cqglmqfcggelqaeasailntpvcgipfsqwgtiggaasayvasgvdltqaaneikgla
    qqmqkllslmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy5A (A:)
    tsfsdsikqlaaetlpkymqqlnsldaemlqknhdqfatgsgplrgsitqcqglmqfcgg
    elqaeasailntpvcgipfsqwgtiggaasayvasgvdltqaaneikglaqqmqkllslm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hy5B (B:)
    aptpaqmpsptsfsdsikqlaaetlpkymqqlnsldaemlqknhdqfatgsgplrgsitq
    cqglmqfcggelqaeasailntpvcgipfsqwgtiggaasayvasgvdltqaaneikgla
    qqmqkllslmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy5B (B:)
    tsfsdsikqlaaetlpkymqqlnsldaemlqknhdqfatgsgplrgsitqcqglmqfcgg
    elqaeasailntpvcgipfsqwgtiggaasayvasgvdltqaaneikglaqqmqkllslm
    h