PDB entry 1hy3

View 1hy3 on RCSB PDB site
Description: crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
Deposited on 2001-01-17, released 2002-06-19
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1hy3a_
  • Chain 'B':
    Domains in SCOP 1.63: d1hy3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hy3A (A:)
    nseldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiy
    kegdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekd
    ckiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwek
    gksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnytt
    lpdeimnqklspfmrkgitgdwknhftealnekfdkhyeqqmkestlkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy3A (A:)
    nseldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiy
    kegdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekd
    ckiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwek
    gksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnytt
    lpdeimnqkpfmrkgitgdwknhftealnekfdkhyeqqmkestlkf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hy3B (B:)
    seldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiyk
    egdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekdc
    kiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwekg
    ksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnyttl
    pdeimnqklspfmrkgitgdwknhftealnekfdkhyeqqmkestlkf