PDB entry 1hy1

View 1hy1 on RCSB PDB site
Description: crystal structure of wild type duck delta 2 crystallin (eye lens protein)
Class: lyase
Keywords: eye lens protein, delta 2 crystallin, argininosuccinate lyase
Deposited on 2001-01-17, released 2001-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta crystallin II
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hy1a_
  • Chain 'B':
    Compound: delta crystallin II
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hy1b_
  • Chain 'C':
    Compound: delta crystallin II
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hy1c_
  • Chain 'D':
    Compound: delta crystallin II
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hy1d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hy1A (A:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy1A (A:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hy1B (B:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy1B (B:)
    stdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseews
    kgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisth
    llqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrin
    vlplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlsk
    maedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlk
    glpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlal
    ylvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsve
    qytalagtakssvttqieqlrelmkkqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hy1C (C:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy1C (C:)
    stdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseews
    kgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisth
    llqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrin
    vlplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlsk
    maedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlk
    glpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlal
    ylvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsve
    qytalagtakssvttqieqlrelmkkqke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hy1D (D:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy1D (D:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqkeq