PDB entry 1hy0

View 1hy0 on RCSB PDB site
Description: crystal structure of wild type duck delta 1 crystallin (eye lens protein)
Deposited on 2001-01-17, released 2001-04-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-21, with a file datestamp of 2001-04-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1hy0a_
  • Chain 'B':
    Domains in SCOP 1.57: d1hy0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hy0A (A:)
    dpimqmlstsisteqrlsevdiqasiayakalekagiltktelekilsglekiseelskg
    vivvtqsdediqtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisthll
    qliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinvl
    plgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlskma
    edliiystsefgfltlsdafstgsslmpqkknpdslelirsksgrvfgrlasilmvlkgl
    pstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlalyl
    vrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsveqy
    talggtakssvttqieqlrelmkkqke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hy0B (B:)
    dpimqmlstsisteqrlsevdiqasiayakalekagiltktelekilsglekiseelskg
    vivvtqsdediqtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisthll
    qliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinvl
    plgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlskma
    edliiystsefgfltlsdafstgsslmpqkknpdslelirsksgrvfgrlasilmvlkgl
    pstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlalyl
    vrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsveqy
    talggtakssvttqieqlrelmkkqkeq