PDB entry 1hxy

View 1hxy on RCSB PDB site
Description:
Deposited on 2001-01-17, released 2001-06-27
The last revision prior to the SCOP 1.63 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1hxya1, d1hxya2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1hxyb1, d1hxyb2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1hxyd1, d1hxyd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxyA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hxyB (B:)
    trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
    sqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsgf
    ypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxyB (B:)
    trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
    sqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvyphnllvcsvsgfypgsievr
    wfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvtspltvewra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxyD (D:)
    dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
    laqkfknknvdiygasfyykcekiseniseclyggttlnseklaqerviganvwvdgiqk
    etelirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiydl
    kgendyeidkiyednktlksddishidvnlyt