PDB entry 1hxv

View 1hxv on RCSB PDB site
Description: ppiase domain of the mycoplasma genitalium trigger factor
Class: chaperone
Keywords: FKBP fold, PPIase
Deposited on 2001-01-17, released 2002-05-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trigger Factor
    Species: Mycoplasma genitalium
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hxva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hxvA (A:)
    mrgshhhhhhgseklaktkstmvdvsdkklangdiaiidftgivdnkklasasaqnyelt
    igsnsfikgfetgliamkvnqkktlaltfpsdyhvkelqskpvtfevvlkaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxvA (A:)
    klangdiaiidftgivdnkklasasaqnyeltigsnsfikgfetgliamkvnqkktlalt
    fpsdyhvkelqskpvtfevvlkaik