PDB entry 1hxr

View 1hxr on RCSB PDB site
Description: crystal structure of mss4 at 1.65 angstroms
Class: metal binding protein
Keywords: nucleotide exchange factor, Rab GTPase, membrane trafficking, Zn binding site, METAL BINDING PROTEIN
Deposited on 2001-01-16, released 2001-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide exchange factor MSS4
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hxra_
  • Chain 'B':
    Compound: Guanine nucleotide exchange factor MSS4
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hxrb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hxrA (A:)
    elvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpdlvdgsnpdgdvleeh
    wlvndmfifenvgftkdvgnvkflvcadceigpigwhclddknsfyvalervshe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxrA (A:)
    elvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpdgdvleehwlvndmfi
    fenvgftkdvgnvkflvcadceigpigwhclddknsfyvalervshe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxrB (B:)
    elvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpdlvdgsnpdgdvleeh
    wlvndmfifenvgftkdvgnvkflvcadceigpigwhclddknsfyvalervshe