PDB entry 1hxq

View 1hxq on RCSB PDB site
Description: the structure of nucleotidylated galactose-1-phosphate uridylyltransferase from escherichia coli at 1.86 angstroms resolution
Class: nucleotidyltransferase
Keywords: metalloenzyme, nucleotidylated histidine, reaction intermediate, nucleotidyltransferase
Deposited on 1996-06-16, released 1997-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexose-1-phosphate uridylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hxqa1, d1hxqa2
  • Chain 'B':
    Compound: hexose-1-phosphate uridylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hxqb1, d1hxqb2
  • Heterogens: ZN, FE, U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hxqA (A:)
    mtqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvr
    vtgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlp
    elsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphphgqiwansflpneae
    redrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkah
    vlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfy
    ppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxqA (A:)
    tqfnpvdhphrrynpltgqwilvsphrakrpwqgavlpahdpdcflcagnvrvtgdknpd
    ytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpelsvaalt
    eivktwqeqtaelgktypwvqvfenkgaamgcsnphphgqiwansflpneaeredrlqke
    yfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkahvlritdlt
    daqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfyppllrsat
    vrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hxqB (B:)
    mtqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvr
    vtgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlp
    elsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphphgqiwansflpneae
    redrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkah
    vlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfy
    ppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxqB (B:)
    tqfnpvdhphrrynpltgqwilvsphrakvlpahdpdcflcagnvrvtgdknpdytgtyv
    ftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpelsvaalteivktw
    qeqtaelgktypwvqvfenkgaamgcsnphphgqiwansflpneaeredrlqkeyfaeqk
    spmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkahvlritdltdaqrsd
    lalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfyppllrsatvrkfmv
    gyemlaetqrdltaeqaaerlravsdihfresg