PDB entry 1hxp

View 1hxp on RCSB PDB site
Description: nucleotide transferase
Class: nucleotidyl transferase
Keywords: metalloenzyme, galactosemia, nucleotidyl transferase, complex (serine protease-inhibitor)
Deposited on 1995-06-09, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexose-1-phosphate uridylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GALT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09148 (Start-347)
      • conflict (33)
    Domains in SCOPe 2.07: d1hxpa1, d1hxpa2
  • Chain 'B':
    Compound: hexose-1-phosphate uridylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GALT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hxpb1, d1hxpb2
  • Heterogens: ZN, FE, BME, U5P, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hxpA (A:)
    mtqfnpvdhphrrynpltgqwilvsphrakrpwegaqetpakqvlpahdpdcflcagnvr
    vtgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlp
    elsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphphgqiwansflpneae
    redrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkah
    vlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfy
    ppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxpA (A:)
    tqfnpvdhphrrynpltgqwilvsphrakrpwegavlpahdpdcflcagnvrvtgdknpd
    ytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpelsvaalt
    eivktwqeqtaelgktypwvqvfenkgaamgcsnphphgqiwansflpneaeredrlqke
    yfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkahvlritdlt
    daqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfyppllrsat
    vrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hxpB (B:)
    mtqfnpvdhphrrynpltgqwilvsphrakrpwegaqetpakqvlpahdpdcflcagnvr
    vtgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlp
    elsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphphgqiwansflpneae
    redrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkah
    vlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfy
    ppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxpB (B:)
    tqfnpvdhphrrynpltgqwilvsphrlpahdpdcflcagnvrvtgdknpdytgtyvftn
    dfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpelsvaalteivktwqeq
    taelgktypwvqvfenkgaamgcsnphphgqiwansflpneaeredrlqkeyfaeqkspm
    lvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkahvlritdltdaqrsdlal
    alkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfyppllrsatvrkfmvgye
    mlaetqrdltaeqaaerlravsdihfres