PDB entry 1hxm

View 1hxm on RCSB PDB site
Description: Crystal Structure of a Human Vgamma9/Vdelta2 T Cell Receptor
Class: immune system
Keywords: Ig domain, T cell receptor, TCR, gdTCR, IMMUNE SYSTEM
Deposited on 2001-01-16, released 2001-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma-delta T-cell receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VD2, DD3, JD1, CD
    Database cross-references and differences (RAF-indexed):
    • GB CAA51166 (0-End)
    Domains in SCOPe 2.07: d1hxma1, d1hxma2
  • Chain 'B':
    Compound: gamma-delta T-cell receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VG9, JGP, CG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hxmb1, d1hxmb2
  • Chain 'C':
    Compound: gamma-delta T-cell receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VD2, DD3, JD1, CD
    Database cross-references and differences (RAF-indexed):
    • GB CAA51166 (0-End)
    Domains in SCOPe 2.07: d1hxmc1, d1hxmc2
  • Chain 'D':
    Compound: gamma-delta T-cell receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VG9, JGP, CG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hxmd1, d1hxmd2
  • Chain 'E':
    Compound: gamma-delta T-cell receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VD2, DD3, JD1, CD
    Database cross-references and differences (RAF-indexed):
    • GB CAA51166 (0-End)
    Domains in SCOPe 2.07: d1hxme1, d1hxme2
  • Chain 'F':
    Compound: gamma-delta T-cell receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VG9, JGP, CG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hxmf1, d1hxmf2
  • Chain 'G':
    Compound: gamma-delta T-cell receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VD2, DD3, JD1, CD
    Database cross-references and differences (RAF-indexed):
    • GB CAA51166 (0-End)
    Domains in SCOPe 2.07: d1hxmg1, d1hxmg2
  • Chain 'H':
    Compound: gamma-delta T-cell receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: VG9, JGP, CG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hxmh1, d1hxmh2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hxmA (A:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfevktdstdhvkpketentkqpsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxmA (A:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hxmB (B:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppiktdvitmdpk
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxmB (B:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hxmC (C:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfevktdstdhvkpketentkqpsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxmC (C:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hxmD (D:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppiktdvitmdpk
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxmD (D:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hxmE (E:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfevktdstdhvkpketentkqpsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxmE (E:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hxmF (F:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppiktdvitmdpk
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxmF (F:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1hxmG (G:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfevktdstdhvkpketentkqpsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxmG (G:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1hxmH (H:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppiktdvitmdpk
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxmH (H:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi