PDB entry 1hxi

View 1hxi on RCSB PDB site
Description: an unexpected extended conformation for the third tpr motif of the peroxin pex5 from trypanosoma brucei
Class: transport protein
Keywords: alpha helical
Deposited on 2001-01-15, released 2001-03-21
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome targeting signal 1 receptor PEX5
    Species: Trypanosoma brucei
    Gene: PEX5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U763
      • modified residue (14)
      • modified residue (20)
      • modified residue (26)
      • modified residue (78)
    Domains in SCOP 1.75: d1hxia_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1hxiA (A:)
qnntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslglt
qaenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawllsqpqyeq
l

    Sequence, based on observed residues (ATOM records): (download) 
    >1hxiA (A:)
nntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslgltq
aenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawll