PDB entry 1hxi

View 1hxi on RCSB PDB site
Description: an unexpected extended conformation for the third tpr motif of the peroxin pex5 from trypanosoma brucei
Deposited on 2001-01-15, released 2001-03-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1hxia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxiA (A:)
    nntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslgltq
    aenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawll