PDB entry 1hxg

View 1hxg on RCSB PDB site
Description: crystal structure of teas w273s/c440w
Class: lyase
Keywords: isoprenoid synthase, isoprenoid cyclase, 5-epi-aristolochene synthase, isoprenoid biosynthesis, natural products biosynthesis, lyase
Deposited on 2001-01-12, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.217
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-epi-aristolochene synthase
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q40577 (Start-547)
      • engineered (272)
      • engineered (439)
      • see remark 999 (531)
    Domains in SCOPe 2.07: d1hxga1, d1hxga2
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hxgA (A:)
    masaavanyeeeivrpvadfspslwgdqflsfsidnqvaekyakeiealkeqtrnmllat
    gmkladtlnlidtierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfn
    ispeifskfqdengkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaap
    hlksplreqvthaleqclhkgvprvetrffissiydkeqsknnvllrfakldfnllqmlh
    kqelaqvsrwwkdldfvttlpyardrvvecyfsalgvyfepqysqarvmlvktismisiv
    ddtfdaygtvkeleaytdaiqrwdineidrlpdymkisykaildlykdyekelssagrsh
    ivchaiermkevvrnynvestwfiegytppvseylsnalatttyyylattsylgmksate
    qdfewlsknpkileasviiwrviddtatyeveksrgqiatgieccmrdygistkeamakf
    qnmaetawkdinegllrptpvstefltpilnlarivevtyihnldgythpeevlkphiin
    llvdsiki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxgA (A:)
    rpvadfspslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidti
    erlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdeng
    kfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthal
    eqclhkgvprvetrffissiydkeqsknnvllrfakldfnllqmlhkqelaqvsrwwkdl
    dfvttlpyardrvvecyfsalgvyfepqysqarvmlvktismisivddtfdaygtvkele
    aytdaiqrwdineidrlpdymkisykaildlykdyekelssagrshivchaiermkevvr
    nynvestwfiegytppvseylsnalatttyyylattsylgmksateqdfewlsknpkile
    asviiwrviddtatyeveksrgqiatgieccmrdygistkeamakfqnmaetawkdineg
    llrptpvstefltpilnlarivevtyihnldgythpeevlkphiinllvdsiki