PDB entry 1hxd

View 1hxd on RCSB PDB site
Description: crystal structure of e. coli biotin repressor with bound biotin
Class: ligase
Keywords: Ligase, Repressor, BIOTIN, DNA-Binding
Deposited on 2001-01-12, released 2001-05-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BirA BIFUNCTIONAL PROTEIN
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1hxda1, d1hxda2, d1hxda3
  • Chain 'B':
    Compound: BirA BIFUNCTIONAL PROTEIN
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1hxdb1, d1hxdb2, d1hxdb3
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hxdA (A:)
    mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
    pepiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrg
    rkwfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylq
    drklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaa
    mlirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgalll
    eqdgiikpwmggeislrsaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxdA (A:)
    ntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpep
    iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
    fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
    lagilveltgktgdaaqivigaginmamqgwitlqeaginldrntlaamlirelraalel
    feqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgallleqdgiikpwmgg
    eislr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hxdB (B:)
    mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
    pepiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrg
    rkwfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylq
    drklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaa
    mlirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgalll
    eqdgiikpwmggeislrsaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hxdB (B:)
    ntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpep
    iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
    fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
    lagilveltgktgdaaqivigaginmamqgwitlqeaginldrntlaamlirelraalel
    feqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgallleqdgiikpwmgg
    eislr